Protein Info for GFF3933 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 121 to 134 (14 residues), see Phobius details amino acids 144 to 186 (43 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details amino acids 219 to 243 (25 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details amino acids 293 to 312 (20 residues), see Phobius details amino acids 337 to 360 (24 residues), see Phobius details amino acids 372 to 393 (22 residues), see Phobius details amino acids 406 to 424 (19 residues), see Phobius details amino acids 431 to 449 (19 residues), see Phobius details PF09913: DUF2142" amino acids 20 to 416 (397 residues), 190.6 bits, see alignment E=2.1e-60

Best Hits

KEGG orthology group: None (inferred from 70% identity to sch:Sphch_1062)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (480 amino acids)

>GFF3933 hypothetical protein (Sphingobium sp. HT1-2)
MAIAAPWSRLERIVLLAICLATLFFATLTPPFQAPDENQHYMKALALSQGHVVTEVHGDR
IGAELPRAAVDLHAVDFPTEPDGKRHRYDKAMIDRAWSADAARPGTRFAEFPNVASYAPT
LYAPGAVGLAIGDALGLPRIGTFYAGRIANALTALLLLAAALRLIPFGRMALLGTALLPT
FCYQIGSLSPDAVINGVGFLGLALALRIGFMAPDRASTAATLVTAPLLALAKGVYLPLMA
AGLRWPSRASLLRNALILCAMLLGTVIFAVWMKANGGSQALYHITSRKTGESVLTAPLAQ
QLAVILADPAGYARILVSSIVERAPVYALQIVGRFGWNAILLPLLAYPLALLMLGSAVLS
GSGVRFGLGQRLWWLAIALGTALLIETAMYLTGTPLGADYVQGTQGRYFLPLLLLVLLAL
MPANPLRRARLLCVGAGLALLIIAMLSAWDSFWVHGFVTADGMPPHSSIGRALLLPSPRW