Protein Info for GFF3931 in Xanthobacter sp. DMC5

Annotation: S-adenosylmethionine/S-adenosylhomocysteine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 16 to 40 (25 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 139 to 158 (20 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 226 to 249 (24 residues), see Phobius details amino acids 260 to 277 (18 residues), see Phobius details amino acids 284 to 305 (22 residues), see Phobius details PF00892: EamA" amino acids 21 to 153 (133 residues), 72.3 bits, see alignment E=2.5e-24 amino acids 166 to 300 (135 residues), 60.3 bits, see alignment E=1.3e-20

Best Hits

KEGG orthology group: None (inferred from 78% identity to xau:Xaut_2045)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>GFF3931 S-adenosylmethionine/S-adenosylhomocysteine transporter (Xanthobacter sp. DMC5)
MTATPLPLAASRRTDALLPVFIAAFCIIWSSAFAVAKVALADCPPLLLLSGRFLVAGLLV
LGGCVLFLPASHFRRLNLRDIAALAAMGILNNAVYLGLSYVGMTHVSSGFTAVLVSANPL
LTALGAAVLLGERLTGRKLLGLVLGMIGVAIVVRSRIVSGHEDPLGTAYVVGALLALTAA
TLMFKKVRTSASLFVGSGIQSLAGGIALLPVALWREDVASIHPTLTLGLSFAWLTLAGSV
GAFSLWFFILGRTSATRASALHFLMPPLGLMFGWLLLGEPVPPLDLVGIVPIALGIRLVT
TAPAVQKR