Protein Info for GFF3931 in Sphingobium sp. HT1-2

Annotation: Dihydrolipoamide dehydrogenase of pyruvate dehydrogenase complex (EC 1.8.1.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07992: Pyr_redox_2
  • amino acids 5 to 326 (322 residues), 236.2 bits, E=3e-73
• TIGR01350: dihydrolipoyl dehydrogenase
  • amino acids 5 to 471 (467 residues), 566.7 bits, E=1.8e-174
• PF12831: FAD_oxidored
  • amino acids 6 to 52 (47 residues), 27.8 bits, 8.8e-10
• PF01134: GIDA
  • amino acids 6 to 144 (139 residues), 26.8 bits, E=1.6e-09
• PF00890: FAD_binding_2
  • amino acids 6 to 43 (38 residues), 26.3 bits, 2.4e-09
• PF13738: Pyr_redox_3
  • amino acids 8 to 310 (303 residues), 65.5 bits, E=2.7e-21
• PF00070: Pyr_redox
  • amino acids 174 to 247 (74 residues), 76.4 bits, E=1.1e-24
• PF02852: Pyr_redox_dim
  • amino acids 352 to 460 (109 residues), 123.4 bits, E=2.8e-39

Best Hits

Swiss-Prot: 62% identical to DLDH_ZYMMO: Dihydrolipoyl dehydrogenase (lpd) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 86% identity to sch:Sphch_1064)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of pyruvate dehydrogenase complex (EC 1.8.1.4)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (3/3 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Protein Sequence (471 amino acids)

>GFF3931 Dihydrolipoamide dehydrogenase of pyruvate dehydrogenase complex (EC 1.8.1.4) (Sphingobium sp. HT1-2)
MADTYDLIVLGSGPGGYVAAIRAAQLGLKTAIVERENLGGICLNWGCIPTKALLRSAEIF
HYMQHAKDYGLVAEKISADIEAVVKRSRGVAKQLNQGVTHLMKKNKITVHMGDGKLTGKG
KLTVTKDGKSEELTAKHIIVATGARARDLPQLKADGKRVWTYRHAMTPAEMPTKLLVIGS
GAIGIEFASFYNDMGADVTVVEMMDRIVPVEDADVSAFLEKAVKKQGMTILTGAKIEKIA
ATDKAVTATIKDKAGKDITAEYSHVIVAIGIVPNVENIGLEEVGVEPDQRFHIKTDPYGR
TNVDGIWAIGDVTAPPWLAHKASHEAVTTVEAIAQALGNKDVHPHAMDVRNIPGCTYCHP
QIASVGLTEAKAKEAGYDVKVGMFPFIGNGKAIALGEAEGFTKTVFDAKTGELLGAHMIG
AEVTEMIQGYTIGKTLETTEAELMQTVFPHPTISESMHESVLAAYGRALHI