Protein Info for GFF3925 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: SSU ribosomal protein S6p

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00166: ribosomal protein bS6
  • amino acids 1 to 92 (92 residues), 107.7 bits, E=1.4e-35
• PF01250: Ribosomal_S6
  • amino acids 3 to 90 (88 residues), 105.7 bits, E=5.6e-35

Best Hits

Swiss-Prot: 89% identical to RS6_RHOFT: 30S ribosomal protein S6 (rpsF) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K02990, small subunit ribosomal protein S6 (inferred from 89% identity to rfr:Rfer_2193)

MetaCyc: 58% identical to 30S ribosomal subunit protein S6 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S6p" in subsystem Ribosome SSU bacterial

Protein Sequence (128 amino acids)

>GFF3925 SSU ribosomal protein S6p (Hydrogenophaga sp. GW460-11-11-14-LB1)
MRHYEIVLLIHPDQSEQVPAMLERYKGMITNGGGKIHRVEDWGRRQMAYQINKLSKAHYL
CVNIEADQAVMAELEHAFKFNDAVLRHLTVLRKKADTGPSAMMKSVEREEARKLQQPAPH
QSQEQAAA