Protein Info for GFF3923 in Variovorax sp. SCN45

Annotation: Kynurenine formamidase, bacterial (EC 3.5.1.9)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 TIGR03035: arylformamidase" amino acids 8 to 214 (207 residues), 292.5 bits, see alignment E=1.1e-91 PF04199: Cyclase" amino acids 11 to 157 (147 residues), 63 bits, see alignment E=1.9e-21

Best Hits

Swiss-Prot: 81% identical to KYNB_POLSJ: Kynurenine formamidase (kynB) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K07130, (no description) (inferred from 92% identity to vap:Vapar_1449)

Predicted SEED Role

"Kynurenine formamidase, bacterial (EC 3.5.1.9)" in subsystem Aromatic amino acid degradation or NAD and NADP cofactor biosynthesis global (EC 3.5.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (216 amino acids)

>GFF3923 Kynurenine formamidase, bacterial (EC 3.5.1.9) (Variovorax sp. SCN45)
MASSHQQRIWDISPPVHEGAPVFPGDTPYQQRWAATISPGCPVNVSEIKLSPHVGAHADA
PLHYDPDGQTIGNVDLAPFLGPCRVIHAIAQGPLIEWEHIAHAIDSHLPQRVLVRTYDSM
PVGHWDPQLAAYAPATVERLAAMGVKLIGIDTASIDPADSKTLESHQRIRRLDLRVLENL
VLDDVPEGDYELIALPLKLVSADASPVRAVLRELPR