Protein Info for GFF3923 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Permeases of the major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 560 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 191 to 214 (24 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details amino acids 461 to 485 (25 residues), see Phobius details amino acids 505 to 524 (20 residues), see Phobius details amino acids 530 to 548 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 21 to 232 (212 residues), 109.2 bits, see alignment E=2.4e-35 amino acids 457 to 555 (99 residues), 23.7 bits, see alignment E=2.2e-09 PF07690: MFS_1" amino acids 25 to 337 (313 residues), 89.2 bits, see alignment E=2.7e-29

Best Hits

KEGG orthology group: None (inferred from 76% identity to adk:Alide2_4133)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (560 amino acids)

>GFF3923 Permeases of the major facilitator superfamily (Hydrogenophaga sp. GW460-11-11-14-LB1)
MATSTASASAPMTKEERKVIFASSLGTVFEWYDFYLYGSLAAIIARQFFSGLDPTSAYIF
ALLAFAAGFLVRPFGAIFFGRLGDMIGRKYTFLVTILIMGASTFIVGLLPSYASIGLAAP
VILIILRMLQGLALGGEYGGAATYVAEHAPHGKRGAYTAWIQTTATLGLFLSLLVILGVR
TAMGDKEFGEWGWRIPFLVSILLLGISVWIRLSLNESPAFQKMKSEGKTSKAPLTESFGQ
WKNLKVVILALLGLTAGQAVVWYTGQFYALFFLTTIAKVDATTANLLIAASLLIGTPFFI
FFGTLSDKIGRKPIIMGGCLIAALTYFTVFPMLLNYANPALVAAQKANKVTVTADLKECS
FQGSPIARDIDFRTSCDIAKRALTQAYIPYTSVQGPAGAPATVTMGDKVLNSPVGVLNEK
RDAFAADSAKTIADFRKALTDTAKAEGLTTPADPAKMNKGMVLLILVFLVILVTMVYGPI
AAMLVEMFPTRIRYTSMSLPYHIGNGWFGGLLPTTAFAMVAATGDIFYGLWYPVIVAAGT
FIIGMIFIRETKDVDIYAKD