Protein Info for GFF3918 in Sphingobium sp. HT1-2

Annotation: Periplasmic aromatic aldehyde oxidoreductase, iron-sulfur subunit YagT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 49 to 102 (54 residues), 41.8 bits, E=1.2e-14
• PF13085: Fer2_3
  • amino acids 78 to 129 (52 residues), 27.3 bits, E=4.4e-10
• PF01799: Fer2_2
  • amino acids 116 to 203 (88 residues), 94 bits, E=7.3e-31

Best Hits

Swiss-Prot: 63% identical to PAOA_ECOLI: Aldehyde oxidoreductase iron-sulfur-binding subunit PaoA (paoA) from Escherichia coli (strain K12)

KEGG orthology group: K13483, xanthine dehydrogenase YagT iron-sulfur-binding subunit (inferred from 71% identity to smt:Smal_1993)

MetaCyc: 63% identical to aldehyde dehydrogenase, Fe-S subunit (Escherichia coli K-12 substr. MG1655)
Carboxylate reductase. [EC: 1.2.99.6]; 1.2.98.- [EC: 1.2.99.6]; 1.2.98.- [EC: 1.2.99.6]

Predicted SEED Role

"Periplasmic aromatic aldehyde oxidoreductase, iron-sulfur subunit YagT"

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.99.6

Protein Sequence (211 amino acids)

>GFF3918 Periplasmic aromatic aldehyde oxidoreductase, iron-sulfur subunit YagT (Sphingobium sp. HT1-2)
MADFPDMGVSRRGILAGGAASATVAVIPAPVQAQPSPAAPPPMMAVDFIVNGKRQQLKLD
TRTTLLDALREHLKLTGTKKGCDHGQCGACTVMVNGTRINSCLSLALQHQGDEITTIEGL
GMPDNLHPMQAAFIAHDGYQCGYCTPGQICSAVAVLKEIEQGVPSHVQTDITRAPDYSNI
EMRERMSGNLCRCGAYSNIAQAMAQVAGAKA