Protein Info for GFF3915 in Variovorax sp. SCN45

Annotation: Ferrous iron transport periplasmic protein EfeO, contains peptidase-M75 domain and (frequently) cupredoxin-like domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF09375: Peptidase_M75" amino acids 39 to 270 (232 residues), 144.6 bits, see alignment E=2.4e-46

Best Hits

Swiss-Prot: 43% identical to EFEMO_STAHJ: Efem/EfeO family lipoprotein (SH0684) from Staphylococcus haemolyticus (strain JCSC1435)

KEGG orthology group: K07224, putative lipoprotein (inferred from 66% identity to pde:Pden_1736)

Predicted SEED Role

"Ferrous iron transport periplasmic protein EfeO, contains peptidase-M75 domain and (frequently) cupredoxin-like domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>GFF3915 Ferrous iron transport periplasmic protein EfeO, contains peptidase-M75 domain and (frequently) cupredoxin-like domain (Variovorax sp. SCN45)
MTVQFRRHFLATFVAGFAGLYALGAQAAVSPLELVGPISDYKIYVAENVRKLATDTRAFT
AAVKAGDIEKAKKLYAPTRTSYERIEPVAELFNDLDKSIDSRADDHEKAEKDPAFGGFHR
IEYGLWVQKSTKELNPVADKLLADVLELQKRLVALTFPPEKVVGGAAVLMEEVAATKISG
EENRYSHTDLWDFQSNFEGAYKIVELLRPLVVKENKAFSDKTDANFKVVFDTLAKYKTAD
GGFETYSKLTERDRKLLAGRVNTLAEDLSKLRGMLGLN