Protein Info for GFF3914 in Xanthobacter sp. DMC5

Annotation: Adenosylhomocysteinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 PF05221: AdoHcyase" amino acids 4 to 464 (461 residues), 496 bits, see alignment E=7.1e-153 TIGR00936: adenosylhomocysteinase" amino acids 5 to 457 (453 residues), 605.3 bits, see alignment E=2.8e-186 PF00670: AdoHcyase_NAD" amino acids 226 to 385 (160 residues), 265.5 bits, see alignment E=3.9e-83 PF07991: KARI_N" amino acids 246 to 309 (64 residues), 26.2 bits, see alignment E=1.1e-09 PF02826: 2-Hacid_dh_C" amino acids 246 to 335 (90 residues), 30 bits, see alignment E=6.7e-11

Best Hits

Swiss-Prot: 83% identical to SAHH_METC4: Adenosylhomocysteinase (ahcY) from Methylobacterium extorquens (strain CM4 / NCIMB 13688)

KEGG orthology group: K01251, adenosylhomocysteinase [EC: 3.3.1.1] (inferred from 95% identity to xau:Xaut_0186)

Predicted SEED Role

"Adenosylhomocysteinase (EC 3.3.1.1)" in subsystem Methionine Biosynthesis or Methionine Degradation (EC 3.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (465 amino acids)

>GFF3914 Adenosylhomocysteinase (Xanthobacter sp. DMC5)
MSNDYVVKDINLADWGRKELDIAEIEMPGLMATRAEYGPSQPLKGARIAGSLHMTIQTGV
LIETLKALGADVRWASCNIYSTQDHAAAAIAAAGTPVFAIKGETLEEYWEYTHRIFEWAD
GGTPNMILDDGGDATLLVHLGKRAEEGDTAFLDGATNEEEEVLFAAIKRRLKHKPGWYSQ
LAKNIKGVTEETTTGVHRLYEMQKKGTLLWPAINVNDSVTKSKFDNLYGCRESLVDGIRR
GTDVMMAGKVAMVAGFGDVGKGSAASLRNAGCRVMVSEVDPICALQAAMEGYEVVTMEEA
APRADIFVTATGNVDVITVEHMRAMKDRAIVCNIGHFDSEIQVAALKNFKWHNVKPQVDE
VEFADGKRIILLSEGRLVNLGNATGHPSFVMSASFTNQTLAQIELFTKPGHYDKKVYTLP
KALDEKVAALHLDKIGVKLTRLTDQQSAYIGVAQQGPFKPEHYRY