Protein Info for GFF3914 in Variovorax sp. SCN45

Annotation: Ferrous iron transport peroxidase EfeB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01412: Tat-translocated enzyme
  • amino acids 15 to 439 (425 residues), 497.8 bits, E=2.5e-153
• TIGR01413: Dyp-type peroxidase family
  • amino acids 78 to 428 (351 residues), 290.3 bits, E=2.1e-90
• PF04261: Dyp_perox_N
  • amino acids 78 to 228 (151 residues), 121.9 bits, E=2.3e-39
• PF20628: Dyp_perox_C
  • amino acids 244 to 427 (184 residues), 166.8 bits, E=3.8e-53

Best Hits

Swiss-Prot: 61% identical to EFEB_SHIBS: Deferrochelatase/peroxidase EfeB (efeB) from Shigella boydii serotype 4 (strain Sb227)

KEGG orthology group: K07223, putative iron-dependent peroxidase (inferred from 72% identity to pfo:Pfl01_2874)

MetaCyc: 61% identical to heme-containing peroxidase/deferrochelatase (Escherichia coli K-12 substr. MG1655)
PROTOHEMEFERROCHELAT-RXN [EC: 4.98.1.1]

Predicted SEED Role

"Ferrous iron transport peroxidase EfeB"

MetaCyc Pathways

• superpathway of heme b biosynthesis from glutamate (9/10 steps found)
• superpathway of heme b biosynthesis from glycine (6/8 steps found)
• heme b biosynthesis I (aerobic) (3/4 steps found)
• heme b biosynthesis II (oxygen-independent) (3/4 steps found)
• heme b biosynthesis V (aerobic) (3/4 steps found)
• superpathway of heme b biosynthesis from uroporphyrinogen-III (4/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.98.1.1

Protein Sequence (441 amino acids)

>GFF3914 Ferrous iron transport peroxidase EfeB (Variovorax sp. SCN45)
MEQSKNNEAVPAEGRPESPHRRRMLGAAGVAFAGLAASARAGAAPSGPPNSPDSGAQVTD
APQSTHTQDRVPFRGKHQAGIVTPRPTAGMIASFYVLAENRADLERLFRTLTERIAFLTQ
GGPQTDPDPKLPPAGSGILGPVVQPDGLTVTVSVGTSLFDERFGLAKKKPVRLNQMQRHP
NDALDAALCHGDLSIQFCANTPDTNIHALRDIIKNTPDLLVLHWKQEGSVPPIPAVPGKP
AESARNFLGFRDGSANPDSADDKLMDGIVWVQPGSDEPAWAVGGSYQAVRIIRNFVERWD
RTPLQEQEAIMGRLKPTGAPMDGGKTEHDVPDYAKDPEGKATPMDAHIRLANPRTKASDK
NLMLRRPFNYSNGVTKSGQLEMGLLFICYQANLENGFIAVQTRLDGEPLEEYIKPIGGGF
FFTLPGVRDERDWLGRSLMAA