Protein Info for GFF3913 in Variovorax sp. SCN45

Annotation: Ferrous iron transport periplasmic protein EfeO, contains peptidase-M75 domain and (frequently) cupredoxin-like domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details PF13473: Cupredoxin_1" amino acids 28 to 136 (109 residues), 79.6 bits, see alignment E=1.7e-26 PF09375: Peptidase_M75" amino acids 157 to 386 (230 residues), 100.3 bits, see alignment E=1.6e-32

Best Hits

Swiss-Prot: 48% identical to EFEO_ECOUT: Iron uptake system component EfeO (efeO) from Escherichia coli (strain UTI89 / UPEC)

KEGG orthology group: None (inferred from 52% identity to oan:Oant_3858)

MetaCyc: 48% identical to ferrous iron transport system protein EfeO (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Ferrous iron transport periplasmic protein EfeO, contains peptidase-M75 domain and (frequently) cupredoxin-like domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>GFF3913 Ferrous iron transport periplasmic protein EfeO, contains peptidase-M75 domain and (frequently) cupredoxin-like domain (Variovorax sp. SCN45)
MSSSSPDNKPSTSNLMRAAVAGSALLVVAGLAAFWYASNEARKAPPKTADNAVTVTIQGN
ACDPNEITVPAGRTTFTIVNKSNRALEWEILDGVMVVEERENIAPGFSQTMTVKLQPGEF
AITCGLLSNPRGKLVVTPSAASDAEAARPSLVNYVGALAEYQTFLRLEAGSLEDAVSALS
EAIKAGDLQQARALYTPAHQAYKRIEPMAELFADLDTRINARADYFEKREADAGFTGFHR
IEYALYSQNDVKGLAPVVDKLAGDIGALKERLRGLNMPPERLAGSASKLLRRVADNLPAG
GEDHYGHAEVANLQGTYEGTKKISELLQPLLVKAAPALQKSVDERFAAFDAALAPYREGD
GFKSAPLDEAQRKALAEPVRALAEELGKVNAALGLE