Protein Info for PS417_20030 in Pseudomonas simiae WCS417

Annotation: nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 PF02277: DBI_PRT" amino acids 11 to 346 (336 residues), 442.6 bits, see alignment E=4.6e-137 TIGR03160: nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase" amino acids 14 to 346 (333 residues), 435.6 bits, see alignment E=6.6e-135

Best Hits

Swiss-Prot: 94% identical to COBT_PSEFS: Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (cobT) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K00768, nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase [EC: 2.4.2.21] (inferred from 94% identity to pfs:PFLU4483)

MetaCyc: 41% identical to nicotinate-nucleotide--5-hydroxybenzimidazole phosphoribosyltransferase (Pelobacter propionicus)
Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase. [EC: 2.4.2.21]

Predicted SEED Role

"Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (EC 2.4.2.21)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.4.2.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UA15 at UniProt or InterPro

Protein Sequence (351 amino acids)

>PS417_20030 nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (Pseudomonas simiae WCS417)
MTDTWWLNPCKAIDAHAYEHALARQQQLTKPSGSLGQLEALAVQLAGLQGQVKPLVDHVW
IAIFAGDHGVVAESVSAFPQEVTGQMLHNFVSGGAAISVLARQLEAQLEVVDLGTVTPSL
DLPGVRHLNIGAGTANFVNGPAMTEAQGGLALQAGRDSARRALASGAQLFIGGEMGIGNT
TAASALACALLDCQVSDLTGPGTGLNAQGVSHKVAVIERALALHAGQRGDALQTLFNLGG
FEIAALVGAYLACAQEGIVVLVDGFICTVAALVATRLNPACHEWLVFGHRGAEPGHRHVL
QSLDAKPLLELGLRLGEGSGAALAVPLLRLACALHGQMATFAEAAVADRPV