Protein Info for GFF3912 in Variovorax sp. SCN45

Annotation: Ferrous iron transport permease EfeU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 37 to 58 (22 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 118 to 143 (26 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details amino acids 242 to 264 (23 residues), see Phobius details PF03239: FTR1" amino acids 1 to 260 (260 residues), 205.2 bits, see alignment E=7e-65

Best Hits

Swiss-Prot: 55% identical to EFEU_YERPA: Ferrous iron permease EfeU (efeU) from Yersinia pestis bv. Antiqua (strain Antiqua)

KEGG orthology group: K07243, high-affinity iron transporter (inferred from 69% identity to msl:Msil_1811)

Predicted SEED Role

"Ferrous iron transport permease EfeU"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>GFF3912 Ferrous iron transport permease EfeU (Variovorax sp. SCN45)
MLIPFLIMLREGIEAALIVGIVASYLKQSGRGALMPAVWVGVLLAAALSLFAGAGLQLLA
AEFPQKQQELFEGVVGLIAVVMLTSMVFWMRKAARSIKGELQASIDSALAKGADGQGWAL
IGMVFLAVAREGLESVFFLLAVFQQSSGWEAPVGALAGIAVSVVIGWGLYSGGVRLDLRR
FFRFTGLFILLVAAGLLAGVLRKLHEGGVWNHLQTVVFDMSDTLPMDSPVGAVLSGLLGY
QAAPVVGEVIVYLAFLAVALFFFLRSAPAPAPRAAAAR