Protein Info for PS417_20020 in Pseudomonas simiae WCS417

Annotation: cobalamin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00317: cobalamin 5'-phosphate synthase
  • amino acids 4 to 240 (237 residues), 110.9 bits, E=4.4e-36
• PF02654: CobS
  • amino acids 7 to 238 (232 residues), 174.9 bits, E=1.3e-55

Best Hits

Swiss-Prot: 96% identical to COBS_PSEFS: Adenosylcobinamide-GDP ribazoletransferase (cobS) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K02233, adenosylcobinamide-GDP ribazoletransferase [EC: 2.7.8.26] (inferred from 96% identity to pfs:PFLU4481)

Predicted SEED Role

No annotation

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (31/33 steps found)
• superpathway of adenosylcobalamin salvage from cobinamide I (8/8 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (28/36 steps found)
• superpathway of adenosylcobalamin salvage from cobinamide II (8/9 steps found)
• 2-methyladeninyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
• 5-hydroxybenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
• 5-methoxy-6-methylbenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
• 5-methoxybenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
• 5-methylbenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
• adeninyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
• adenosylcobalamin biosynthesis from adenosylcobinamide-GDP I (3/3 steps found)
• benzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
• 4-methylphenyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (2/3 steps found)
• phenyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (2/3 steps found)
• adenosylcobalamin biosynthesis from adenosylcobinamide-GDP II (2/4 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.26

Sequence Analysis Tools

See U1UYK8 at UniProt or InterPro

Protein Sequence (242 amino acids)

>PS417_20020 cobalamin synthase (Pseudomonas simiae WCS417)
MLPFWIALQFLSSLPIRLPGMPQPQELGRSLLFYPVVGLLFGVLLWGLNSVLMGAPLLLH
AALLLTAWVLLSGGLHLDGLADSADAWLGGFGDRERTLTIMKDPRSGPIAVVTLGMVLLL
KFTALVALIEQPNGAALILAPLIGRASMLALFLTTRYVRAGGLGQALSNHLPRIVGQQVL
ILSGLACILIGGFSGGLAVLLAAICFIGLRQLMVNRLGGTTGDTAGALLELLEVVVLVGL
AL