Protein Info for GFF3904 in Sphingobium sp. HT1-2

Annotation: Lipoprotein releasing system transmembrane protein LolC/LolE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 21 to 48 (28 residues), see Phobius details amino acids 272 to 297 (26 residues), see Phobius details amino acids 317 to 346 (30 residues), see Phobius details amino acids 382 to 402 (21 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 6 to 416 (411 residues), 397.2 bits, see alignment E=4.4e-123 PF12704: MacB_PCD" amino acids 30 to 236 (207 residues), 57.1 bits, see alignment E=3.2e-19 PF02687: FtsX" amino acids 276 to 409 (134 residues), 55.5 bits, see alignment E=6.1e-19

Best Hits

Swiss-Prot: 33% identical to LOLC_XYLFT: Lipoprotein-releasing system transmembrane protein LolC (lolC) from Xylella fastidiosa (strain Temecula1 / ATCC 700964)

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 91% identity to sch:Sphch_0797)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>GFF3904 Lipoprotein releasing system transmembrane protein LolC/LolE (Sphingobium sp. HT1-2)
MILSRYERMIAKRYLLPGKGEGFIFLVAGISLAAVMLGVAALIIVMSVMNGFRAELFDKI
VGLNGHAVVQGYGGRLPDWRDVLKEAKATPGVTSATPLIEQPLLGSYQGRVEGVLVRGMT
VPDIRSNTTLKGKIVAGDLNALTANSEKVGIGVRLAENLGIQVGDHISIMNPAGRSTPFG
TVPRQISYQVAAIFEVGVYDYDKAFVVMPIEDAQTLLLLGDVVSMIEVETVNADRVGSIL
EPLAAKVAGRAVVQDWRQMNASLFEALAVERVAMFVVLSIIVLVAVFNILSSLIMLVRAK
TRDIAILRTMGASRSGLVKIFMTVGVTIGTLGMVAGMVLGFTFLFFRQSVVNVIQFVTGQ
NLWDPSIRFLTELPSKPDPVEIVIICLMALVFSFLATLYPAFKAANTDPVQVLRYE