Protein Info for GFF390 in Sphingobium sp. HT1-2

Annotation: 'Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23)' transl_table=11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 TIGR00576: dUTP diphosphatase" amino acids 7 to 138 (132 residues), 173.1 bits, see alignment E=1.4e-55 PF00692: dUTPase" amino acids 10 to 138 (129 residues), 114.1 bits, see alignment E=3.9e-37 PF22769: DCD" amino acids 26 to 111 (86 residues), 35.4 bits, see alignment E=1.2e-12

Best Hits

Swiss-Prot: 73% identical to DUT_SPHWW: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K01520, dUTP pyrophosphatase [EC: 3.6.1.23] (inferred from 80% identity to sch:Sphch_1595)

Predicted SEED Role

"Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (139 amino acids)

>GFF390 'Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23)' transl_table=11 (Sphingobium sp. HT1-2)
MRLPNGDGLPVPAYATAHAAGMDVVSAEEIILNPGDRHPVATGFALAIPEGYEIQVRPRS
GLALKHGITLPNAPGTIDADYRGELKVLLINHGADPFPIKRGDRIAQLIVAPVQLASFVE
VDMLDDTVRGMGGFGSTGV