Protein Info for GFF39 in Xanthobacter sp. DMC5

Annotation: Spermidine/putrescine transport system permease protein PotB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 114 to 137 (24 residues), see Phobius details amino acids 158 to 182 (25 residues), see Phobius details amino acids 210 to 235 (26 residues), see Phobius details amino acids 262 to 284 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 161 to 284 (124 residues), 51.2 bits, see alignment E=6.7e-18

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 80% identity to azc:AZC_1800)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>GFF39 Spermidine/putrescine transport system permease protein PotB (Xanthobacter sp. DMC5)
MTSLALSHTEPRRLGPLGTASALLLPIAVVNAIGFLWPVVNLLKMSFREAQASGALGAGY
NLDTWTNALTDSFTLELITNSVGVSLLITVLTLIASYPIALYLHRSTGTWRTMLMVLVVA
PLLTSAVVRTYGWIAILSDRGLVANALMALGMAEPPRLMFNLTGVVIGLTEILMPYMILA
LLSGFGRLDPRLEEAALTLGASPLKTFWRVVLPLTAPGMALGGLLCFVLAISSFVTPKLL
GGGRVFLLATEIYDQAIVTLNWPLAAALSMIVLVVFGISLALYARALRRIA