Protein Info for GFF39 in Sphingobium sp. HT1-2

Annotation: Replication-associated recombination protein RarA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 PF05496: RuvB_N" amino acids 24 to 142 (119 residues), 46 bits, see alignment E=1.7e-15 PF07728: AAA_5" amino acids 57 to 147 (91 residues), 22.3 bits, see alignment E=4e-08 PF00004: AAA" amino acids 57 to 166 (110 residues), 54.7 bits, see alignment E=5.2e-18 PF16193: AAA_assoc_2" amino acids 188 to 261 (74 residues), 61 bits, see alignment E=3.8e-20 PF12002: MgsA_C" amino acids 262 to 427 (166 residues), 210.2 bits, see alignment E=6.7e-66

Best Hits

KEGG orthology group: K07478, putative ATPase (inferred from 89% identity to sjp:SJA_C1-14930)

Predicted SEED Role

"FIG065221: Holliday junction DNA helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>GFF39 Replication-associated recombination protein RarA (Sphingobium sp. HT1-2)
MADLFSSDDVLPAGIDHAPLADRLRPAVLADVVGQEHLTGPDGAIGRMVAAGRLSSILFW
GPPGTGKTTISRLLADAVGMRFEPISAVFSGVADLKKVFAAAKDHGRRGEKTLLFVDEIH
RFNRAQQDSFLPFVEDGTVTLVGATTENPSFELNAALLSRAQVLILRRLDADALEQLLDR
AEALIGRPLPLDIAAREALLASADGDGRFLLNQVETLYSIDIPAPLDPAGLSALLHRRVA
VYDKDREGHYNLISALHKSLRGSDPQAALYYLARMLTAGEEPLYVLRRLVRFATEDIGLA
DPQAVIQCLAAKDAYEFLGSPEGELAIVQACIYCATAPKSNAGYMAMKTAFRTARETGSL
MPPMNIVNAPTKLMKQVGYGKNYQYDHDAEGGFSGANYWPEEMSPQTFYTPTERGFEARI
AERIAYWNKLRAERGAA