Protein Info for GFF3899 in Xanthobacter sp. DMC5

Annotation: Succinyl-CoA:coenzyme A transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 TIGR03458: succinate CoA transferase" amino acids 12 to 499 (488 residues), 763 bits, see alignment E=6.1e-234 PF02550: AcetylCoA_hydro" amino acids 17 to 220 (204 residues), 109.5 bits, see alignment E=2.3e-35 PF13336: AcetylCoA_hyd_C" amino acids 330 to 468 (139 residues), 134.6 bits, see alignment E=2.9e-43

Best Hits

Swiss-Prot: 50% identical to SCACT_ACEAC: Succinyl-CoA:acetate CoA-transferase from Acetobacter aceti

KEGG orthology group: K01067, acetyl-CoA hydrolase [EC: 3.1.2.1] (inferred from 92% identity to xau:Xaut_1730)

MetaCyc: 50% identical to succinyl-CoA:acetate CoA-transferase monomer (Acetobacter aceti)
RXN-8807 [EC: 2.8.3.18]

Predicted SEED Role

"Acetyl-CoA hydrolase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.3.18 or 3.1.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (508 amino acids)

>GFF3899 Succinyl-CoA:coenzyme A transferase (Xanthobacter sp. DMC5)
MPENRIRLSSLRDRIVPAEEAAALIGDGMIVGMSGFTRAGEAKAVPMALAARANAAHARG
EPLRITLITGASLGNDLDKQMAEAHLLSRRIPFQSDPALRKAINAGEVMFVDQHLSETVE
HLRTNQLGPIDVAVIEAVGITASGGIIPTTSVGNSATFAILAKKVIVEINLTQPEELEGL
HDIYIPTRRPFREPIPVVTPESRVGLPFIPIDPEKIAAIVVTRKLDSASNVLPPDAETAA
IAGHLMEFLKHEVKIGRLTNRLQPLQAGIGTIANAVMHGFIESPFGDLTMYSEVLQDSTF
DLFDAGKLNFASGSSITLSKAKYDQVMPRITDYKSRLILRPQEISNHPEIIRRLGLIGIN
TALEFDLYGNVNSTHVGGTHMMNGIGGSGDFARNAYLSVFVTKSIAKGGALSSVVPMVSH
VDHTEHDVDILVTEVGLADLRELAPRERARVIIANCVHPLYRDALSDYFERATARGGHTP
HIIEEALAWHVRAREEGTMLPEMTRKIA