Protein Info for GFF3899 in Variovorax sp. SCN45

Annotation: Succinate dehydrogenase cytochrome b-556 subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 transmembrane" amino acids 36 to 57 (22 residues), see Phobius details amino acids 77 to 101 (25 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details PF01127: Sdh_cyt" amino acids 21 to 140 (120 residues), 85.7 bits, see alignment E=1.4e-28 TIGR02970: succinate dehydrogenase, cytochrome b556 subunit" amino acids 21 to 141 (121 residues), 102.5 bits, see alignment E=9e-34

Best Hits

KEGG orthology group: K00241, succinate dehydrogenase cytochrome b-556 subunit (inferred from 89% identity to vpe:Varpa_1574)

Predicted SEED Role

"Succinate dehydrogenase cytochrome b-556 subunit" in subsystem Succinate dehydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (148 amino acids)

>GFF3899 Succinate dehydrogenase cytochrome b-556 subunit (Variovorax sp. SCN45)
MTELANPPRPPRREFRNINAFTDLTTYRLPPAGIVSILHRVSGVIMFLLLPFIIWMFDTS
LSSDYSFAKFKSAFNVGIGFAPGWFFKLVALALIWAYLHHFIAGLRHLWMDVSHSAVTKE
FGHTSALFTLGASIILTLVLGAKLFGLY