Protein Info for PS417_19940 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 729 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF01734: Patatin" amino acids 29 to 221 (193 residues), 126 bits, see alignment E=3.2e-40 PF07244: POTRA" amino acids 334 to 400 (67 residues), 23.1 bits, see alignment E=1.5e-08 PF01103: Omp85" amino acids 450 to 729 (280 residues), 49.3 bits, see alignment E=8.1e-17

Best Hits

KEGG orthology group: K07001, (no description) (inferred from 99% identity to pfs:PFLU4466)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UPJ5 at UniProt or InterPro

Protein Sequence (729 amino acids)

>PS417_19940 membrane protein (Pseudomonas simiae WCS417)
MRRLLSCLFLCLIPLLADAVEPPRPKIGLVLSGGAARGLAHIGVLKALEEQGIQIDAIAG
TSMGAVIGGLYASGYKIDELEKLALSIDWQQALSDAPPREDVPFRRKQDDRDFLVKQKLS
FRDDGSLGLPLGVIQGQNLALLLESMFAHSSNTRNFDKLPIPFRAVATDITTGEKVVFRK
GHLPQVIRASMSIPAVFAPVELDGRLLVDGGMTDNIPLDVAREMGVDIAIVVDIGTPLRS
RKQLATVVDVLNQSITLMTRRNSEEQLKALHPKDVLIQPPLAAYGVTDFGRAKDMIDAGY
RATRALDARLAHVRPAEPIDPQLVAARAPGERTPVITAINVENDSKVSDDVIRYYIRQPL
GEPLNLGRLQTDMGTLYGLDYFEQVQYRVVKKGQDNTLVISARGKRSGTDYLRLGLNLSD
DMRGDSAFNLGASYRMNGINRLGAEWLTRVQIGDRQELYSEFYQPMDTGSRYFVAPYISA
QAQNVELILDNDPISEYRLERYGFGLNVGRQIGNSGEIRFGVGEAWGKADVRIGDRDLPS
VSFSEGFYELKYSFDSLDNVYFPHTGEDIGLAYREFEPGLGSDQRYRQWEFKLDKAMSHG
PDTLVLGGRYGRTLDDSDVVISSFLLGGARQLSGFRQDAISGQNISLMRAVYYRRLTPRS
YLPLDFPLYLGASLERGRAWNNDNEFDSGYINAASIFLGFDTPLGPLNFSYGFNDDNQKA
VYLNLGQTF