Protein Info for GFF3890 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 TIGR01221: dTDP-4-dehydrorhamnose 3,5-epimerase" amino acids 3 to 177 (175 residues), 278.3 bits, see alignment E=1.2e-87 PF00908: dTDP_sugar_isom" amino acids 5 to 176 (172 residues), 258.2 bits, see alignment E=1.5e-81

Best Hits

Swiss-Prot: 100% identical to RMLC_SALTY: dTDP-4-dehydrorhamnose 3,5-epimerase (rfbC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01790, dTDP-4-dehydrorhamnose 3,5-epimerase [EC: 5.1.3.13] (inferred from 100% identity to seh:SeHA_C2320)

MetaCyc: 65% identical to dTDP-4-dehydrorhamnose 3,5-epimerase (Escherichia coli K-12 substr. MG1655)
dTDP-4-dehydrorhamnose 3,5-epimerase. [EC: 5.1.3.13]

Predicted SEED Role

"dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13)" in subsystem Capsular heptose biosynthesis or Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 5.1.3.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>GFF3890 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MIVIKTAIPDVLILEPKVFGDERGFFFESYNQQTFEELIGRKVTFVQDNHSKSKKNVLRG
LHFQRGENAQGKLVRCAVGEVFDVAVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAHG
FVTLSEYAEFLYKATNYYSPSSEGSILWNDEAIGIEWPFSQLPELSAKDAAAPLLDQALL
TE