Protein Info for GFF3885 in Xanthobacter sp. DMC5

Annotation: Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00515: acetyl-CoA carboxylase, carboxyl transferase, beta subunit
  • amino acids 15 to 283 (269 residues), 363.4 bits, E=4.3e-113
• PF01039: Carboxyl_trans
  • amino acids 95 to 243 (149 residues), 60.3 bits, E=7.4e-21

Best Hits

Swiss-Prot: 95% identical to ACCD_XANP2: Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K01963, acetyl-CoA carboxylase carboxyl transferase subunit beta [EC: 6.4.1.2] (inferred from 95% identity to xau:Xaut_1696)

MetaCyc: 46% identical to acetyl-CoA carboxyltransferase beta subunit (Chloroflexus aurantiacus)
RXN0-5055 [EC: 2.1.3.15]

Predicted SEED Role

"Acetyl-coenzyme A carboxyl transferase beta chain (EC 6.4.1.2)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.4.1.2)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (49/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (15/16 steps found)
• biotin-carboxyl carrier protein assembly (4/4 steps found)
• fatty acid biosynthesis initiation (type II) (3/3 steps found)
• propanoyl CoA degradation I (3/3 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (8/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• 3-hydroxypropanoate cycle (10/13 steps found)
• superpathway of fatty acid biosynthesis initiation (4/5 steps found)
• methylaspartate cycle (14/19 steps found)
• 2-oxobutanoate degradation I (3/4 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (12/18 steps found)
• superpathway of the 3-hydroxypropanoate cycle (12/18 steps found)
• fatty acid biosynthesis initiation (type I) (1/3 steps found)
• glyoxylate assimilation (8/13 steps found)
• candicidin biosynthesis (1/6 steps found)
• jadomycin biosynthesis (3/9 steps found)
• superpathway of L-methionine salvage and degradation (8/16 steps found)
• superpathway of candicidin biosynthesis (3/11 steps found)
• superpathway of mycolate biosynthesis (27/239 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis
• Propanoate metabolism
• Pyruvate metabolism
• Tetracycline biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.2

Use Curated BLAST to search for 2.1.3.15 or 6.4.1.2

Protein Sequence (297 amino acids)

>GFF3885 Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (Xanthobacter sp. DMC5)
VNWISNVVRPKIRDFLARREVPENLWVKCPETGQMVFHKDLEANLYVIPASGYHMRMDAV
TRLKNTFDDGAYEEVTLPEVATDPLKFRDERRYVDRLKDARTKTGYQDAVKVATGLLTEL
PVTIAVQDFGFMGGSLGMAAGEAVVKGLETAAERGTPFIMFAASGGARMQEGILSLMQMP
RTTAAIQELREAKKPYIVVLTNPTTGGVTASYAMLGDIQIAEPGALIGFAGPRVIEQTIR
EKLPDGFQRAEYLREHGMIDMVVHRHELRDTLGRLCRMLTKAPALPPKGRLPRPQAA