Protein Info for GFF3885 in Sphingobium sp. HT1-2

Annotation: 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine pyrophosphokinase (EC 2.7.6.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01288: HPPK
  • amino acids 11 to 140 (130 residues), 95.3 bits, E=1.6e-31
• TIGR01498: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
  • amino acids 29 to 140 (112 residues), 84.3 bits, E=4e-28

Best Hits

KEGG orthology group: K00950, 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC: 2.7.6.3] (inferred from 65% identity to sjp:SJA_C1-21910)

Predicted SEED Role

"2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC 2.7.6.3)" in subsystem Folate Biosynthesis (EC 2.7.6.3)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis IV (Plasmodium) (2/3 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (3/5 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis III (Chlamydia) (3/5 steps found)
• superpathway of chorismate metabolism (41/59 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis V (Pyrococcus) (1/4 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis II (Methanocaldococcus) (2/7 steps found)
• tetrahydromethanopterin biosynthesis (3/14 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.6.3

Protein Sequence (169 amino acids)

>GFF3885 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine pyrophosphokinase (EC 2.7.6.3) (Sphingobium sp. HT1-2)
MPDTSHHLYALSIGSNRPLSARLTPPRLLAEAVRRIGALGDVVALSPTIETPPLGPSRRR
FANAALLVASALPPPVLLAALQGIEAGLGRRRFQRWGARRLDIDIILWSGGHWRSRDLLI
PHPAFAQRDFVLRPLGAIAPDWKCPPSGHSVRHLHALLRKASYHRTTRG