Protein Info for PS417_19865 in Pseudomonas simiae WCS417

Annotation: flagellar hook protein FlgK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 681 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details TIGR02492: flagellar hook-associated protein FlgK" amino acids 2 to 356 (355 residues), 235.7 bits, see alignment E=6.7e-74 PF00460: Flg_bb_rod" amino acids 5 to 33 (29 residues), 36.6 bits, see alignment (E = 6.9e-13) PF22638: FlgK_D1" amino acids 92 to 324 (233 residues), 235.1 bits, see alignment E=1.6e-73 PF21158: flgK_1st_1" amino acids 341 to 421 (81 residues), 30.6 bits, see alignment E=5.7e-11 PF06429: Flg_bbr_C" amino acids 641 to 679 (39 residues), 31.2 bits, see alignment 2.5e-11

Best Hits

KEGG orthology group: K02396, flagellar hook-associated protein 1 FlgK (inferred from 81% identity to pfs:PFLU4451)

Predicted SEED Role

"Flagellar hook-associated protein FlgK" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UCZ1 at UniProt or InterPro

Protein Sequence (681 amino acids)

>PS417_19865 flagellar hook protein FlgK (Pseudomonas simiae WCS417)
MSLLSIGMSGLNASQGALSVLSNNIANANTSGYSRQQTTQSASASNPYGGVFIGSGTTLA
DVRRVYNEFLDAAYQNSTALNNDAKAYSSQASAIDKTLSDKTTGMSSVLSAFFAAVQTSA
ANPSDVSARQVLLTSAQTLSNRFNSISTQLNQQKESINGQLKTMSDQVNQLTSSIASLNK
QITQAQGSSNSAPANLLDARNEAVRSLNELVGVTAVEKNGVFSVSTGTGQSLVLGDQSNS
ISAVPSSSDPSQYTIQLNAGGGTSVDMGNVLSGGSIGGLLRYRSDVLMPAINDLGRIAIV
TADTINSQLGQGVDLNGDFGSSLFKDINSAAAIAQRSVGAAGNSAGSGNLNVTISDTSKL
TPYDYKVTFTSGNNYTVMRSDGKSMGAFDTTTTPPPVIDGFTLALDGKGPMAAGDSFKVS
PTANGATNIGTDLKDANKIAFAGPLLGEGSKTNQGTGTFTPPTLTVPIDIHGGANTAQLR
TGIEHSMPVKMVFGKPAADGTQAYTVNDAQGNPIGTGSIIPGQTNKITIDVPMRDANGAL
VVPAKSFKFDTAVGGAPADGDSTTFSFNASGKSDNRNAQALLDLQTKATVGLADGSGGGV
SLVAANSRLVSTVGAKAASGITDTTATGALLKANQDARNSVSQVNLDEEAGDMIKFQQYY
TASSQIIKAAQETFSTLINSL