Protein Info for GFF3873 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: ABC-type transport system involved in resistance to organic solvents, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 transmembrane" amino acids 137 to 148 (12 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 213 to 236 (24 residues), see Phobius details amino acids 263 to 298 (36 residues), see Phobius details amino acids 313 to 340 (28 residues), see Phobius details amino acids 353 to 375 (23 residues), see Phobius details PF02405: MlaE" amino acids 165 to 372 (208 residues), 228 bits, see alignment E=5e-72

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 54% identity to lch:Lcho_1711)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>GFF3873 ABC-type transport system involved in resistance to organic solvents, permease component (Hydrogenophaga sp. GW460-11-11-14-LB1)
VSDTMEVNDETHAPDARWLSQGDDWVLELSGAWREHSAPLPELPADDQIAGAVRVQAADL
RSWDAPLASALWHRVEPLASRGVDVDLQGLPEGLQQILALALDTAPPASSTPAPKPGRIA
RLGARVSAWWALRRKTLTFFGEVLLSLGRWLRGRSDMRASDLAWQIEQTGPRSLPIVALV
CFLVGLIVAYMGAAQLQRFGAQNYIADLVTVGVVREVAALLVGIVLAGRVGAAFAAQIGS
MRANEEVDALATMGVNPVDFLVLPRVLALLIVGPMLTAFGALVGMAVGWLVAVGIYGVTP
LEYVYASAQAITLPHVAVGLIKGTVYSVLVALAGCLQGMAAGRSAQAVGDATTASVVQAI
VWIVVVASVLTVVFQRLDF