Protein Info for PS417_01970 in Pseudomonas simiae WCS417

Annotation: pilus assembly protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details PF04350: PilO" amino acids 50 to 188 (139 residues), 113.6 bits, see alignment E=8.9e-37 PF04351: PilP" amino acids 197 to 315 (119 residues), 105.2 bits, see alignment E=3e-34

Best Hits

KEGG orthology group: K02664, type IV pilus assembly protein PilO (inferred from 81% identity to pfs:PFLU0409)

Predicted SEED Role

"Type IV pilus biogenesis protein PilO / Type IV pilus biogenesis protein PilP" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TUE0 at UniProt or InterPro

Protein Sequence (319 amino acids)

>PS417_01970 pilus assembly protein (Pseudomonas simiae WCS417)
MSLPRLNLSALTHNAAKWSLPGKALLGCALAGVVFVVGDLVYLSPSRERLHQVEAREVAL
QQQVAQKTGLAASLAARTQQLQLMQAKVDERLQALPGESEMPGLLEDIARLALANGLVVE
SVTPLDALSRSFFHEQPVQVGVAGAYHDLAMFLAGLGGLSRIATVHDVVLRRDGKRLRLD
VLAKTYWHAQGGGRLVQRQPFAYDSSALRDPFHRLAVQVDHLKGRPARAPDFARPRGVLE
NLAVDQFEMVGTLSRGVQVFALLRASSKVHRLTVGDYLGPDHGRVTAIHERSVELVELFP
DGQGAWLERPRTLVLNINS