Protein Info for GFF387 in Sphingobium sp. HT1-2

Annotation: 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase (EC 2.1.1.201)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 PF01209: Ubie_methyltran" amino acids 19 to 242 (224 residues), 258.5 bits, see alignment E=1.2e-80 TIGR01934: ubiquinone/menaquinone biosynthesis methyltransferase" amino acids 21 to 242 (222 residues), 263.2 bits, see alignment E=7.7e-83 PF13847: Methyltransf_31" amino acids 59 to 164 (106 residues), 52.9 bits, see alignment E=8.7e-18 PF13649: Methyltransf_25" amino acids 63 to 156 (94 residues), 59.9 bits, see alignment E=8.3e-20 PF08242: Methyltransf_12" amino acids 64 to 158 (95 residues), 34.2 bits, see alignment E=8.5e-12 PF08241: Methyltransf_11" amino acids 64 to 160 (97 residues), 58.1 bits, see alignment E=2.8e-19

Best Hits

Swiss-Prot: 64% identical to UBIE_ZYMMO: Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (ubiE) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 88% identity to sch:Sphch_2915)

MetaCyc: 51% identical to 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase (Xanthomonas campestris pv. campestris)
2-OCTAPRENYL-METHOXY-BENZOQ-METH-RXN [EC: 2.1.1.201]

Predicted SEED Role

"Ubiquinone/menaquinone biosynthesis methyltransferase UbiE (EC 2.1.1.-)" in subsystem Menaquinone Biosynthesis via Futalosine or Menaquinone and Phylloquinone Biosynthesis or Ubiquinone Biosynthesis (EC 2.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.163 or 2.1.1.201

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>GFF387 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase (EC 2.1.1.201) (Sphingobium sp. HT1-2)
MSETASFGYRDVDAAEKAGMVRAVFSNVAAKYDLMNDAMSGGAHRLWKDQFVKRVKPQPG
EQILDMAGGTGDIAFRMHKLGAHITVSDINPEMLAVGVERAQKKGYEGLIWSEQNAETLT
FGDREFDAYTIAFGIRNVTHIDMALREAHRVLKFGGRFFCLEFSTTTWPGFSDVYDSYSH
KLVPQLGKLFANDADSYRYLIESIRRFPPMPKFEGMIRDAGFVNTKVEPILGGLVAIHSG
WKI