Protein Info for GFF3867 in Variovorax sp. SCN45

Annotation: Translation elongation factor LepA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 603 TIGR01393: elongation factor 4" amino acids 3 to 602 (600 residues), 968.2 bits, see alignment E=1.4e-295 PF00009: GTP_EFTU" amino acids 3 to 181 (179 residues), 187.4 bits, see alignment E=4.1e-59 TIGR00231: small GTP-binding protein domain" amino acids 6 to 176 (171 residues), 69.7 bits, see alignment E=2.5e-23 PF03144: GTP_EFTU_D2" amino acids 205 to 275 (71 residues), 34.5 bits, see alignment E=4.6e-12 PF00679: EFG_C" amino acids 406 to 491 (86 residues), 79.3 bits, see alignment E=3.7e-26 PF06421: LepA_C" amino acids 494 to 600 (107 residues), 164.7 bits, see alignment E=1.2e-52

Best Hits

Swiss-Prot: 96% identical to LEPA_VARPS: Elongation factor 4 (lepA) from Variovorax paradoxus (strain S110)

KEGG orthology group: K03596, GTP-binding protein LepA (inferred from 96% identity to vap:Vapar_1399)

Predicted SEED Role

"Translation elongation factor LepA" in subsystem Heat shock dnaK gene cluster extended or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (603 amino acids)

>GFF3867 Translation elongation factor LepA (Variovorax sp. SCN45)
MNHIRNFSIIAHIDHGKSTLADRLIQRCGGLAEREMEAQVLDSMDIEKERGITIKAQTAA
LHYKARDGQVYNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAL
DLGVEVVPVLNKIDLPNADLENARTEIEDVIGIDATDAIPCSAKTGVGIDDILEAIVARM
PAPRGNPDGPLRAMIVDSWFDPYVGVVMLVRVVDGRLVKGERIKMMASGAMYNADSVGVF
TPANEPRPSLEAGEVGYIIAGIKELQAAKVGDTVTLIRPGTGGAAATATEALPGFKEIQP
QVFAGLYPTEASEYDSLRDALEKLKLNDSSLRYEPEVSQALGFGFRCGFLGLLHMEIVQE
RLEREFDQDLITTAPSVVYQVVKNDGEVIMVENPSKMPDVGRMAEIREPIVTVHLYMPQE
YVGSVMTLANQKRGVQMNMAYHGRQVMLTYEMPLGEIVLDFFDKLKSVSRGYASMDYEFK
EYRASDVVKVDILLNGDKVDALSIIVHRSQSQYRGRAVVSKMREIISRQMYDVAIQAAIG
VTIIARETIKALRKNVLAKCYGGDISRKKKLLEKQKAGKKRMKQIGSVEVPQEAFLAILQ
VED