Protein Info for GFF3863 in Variovorax sp. SCN45

Annotation: RNA polymerase sigma factor RpoE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 TIGR02939: RNA polymerase sigma factor RpoE" amino acids 26 to 217 (192 residues), 256.8 bits, see alignment E=1.5e-80 PF07638: Sigma70_ECF" amino acids 31 to 210 (180 residues), 30.1 bits, see alignment E=8.6e-11 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 43 to 210 (168 residues), 99.4 bits, see alignment E=1.7e-32 PF04542: Sigma70_r2" amino acids 47 to 111 (65 residues), 58.2 bits, see alignment E=1.2e-19 PF08281: Sigma70_r4_2" amino acids 157 to 208 (52 residues), 70.7 bits, see alignment E=1.3e-23 PF04545: Sigma70_r4" amino acids 162 to 209 (48 residues), 42.3 bits, see alignment 8.3e-15

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 95% identity to vpe:Varpa_1536)

Predicted SEED Role

"RNA polymerase sigma factor RpoE" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>GFF3863 RNA polymerase sigma factor RpoE (Variovorax sp. SCN45)
MTTSPPPVPPDSGLTDASAAEAPRPGEVDFQLVQRTVAGDQKAFELLVIKYQRRIERLIG
RMVRDVDLIEDIAQETFIRAYRALHQFRGEAQFYTWLYRIAVNTAKKALVDMKRDPTVSE
AALRPSSEDEDETYRPGNEPTTDETPESVLAANEIARAVEAAMEALPAELRQAVTLREIE
GMSYEEIAEVMDCPIGTVRSRIFRAREAISARVKPLLDNQSGKRW