Protein Info for GFF3862 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 18 to 35 (18 residues), see Phobius details amino acids 47 to 71 (25 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 125 to 149 (25 residues), see Phobius details amino acids 161 to 184 (24 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 251 to 270 (20 residues), see Phobius details TIGR03861: alcohol ABC transporter, permease protein" amino acids 24 to 274 (251 residues), 399.3 bits, see alignment E=3.9e-124 PF01061: ABC2_membrane" amino acids 29 to 244 (216 residues), 101 bits, see alignment E=1.1e-32 PF12698: ABC2_membrane_3" amino acids 65 to 267 (203 residues), 70.7 bits, see alignment E=1.8e-23 PF12679: ABC2_membrane_2" amino acids 88 to 271 (184 residues), 48.5 bits, see alignment E=1.1e-16

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 92% identity to xau:Xaut_0025)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>GFF3862 hypothetical protein (Xanthobacter sp. DMC5)
MSEASVAKRPAAPARHLGPAGYLVCMSGIVGRELLRFVQQKERFLSALVRPLVWLFIFAA
GFRSTLGVSIIPPYETYVLYEVYVTPGLAVMIQLFNGMQSSLSMVYDREVGSMRVLLTSP
FPRWYLLLSKLVAGVSVSLAQVYVFLAIARLWEVDIPPMGYLTALPAFILTGLMLGAIGL
VISSLIRQLENFASVMNFVIFPMFFASSALYPLWRIRDASETLYIVCLLNPFTHAVELVR
NALYGAFEPQAFAVVLGTTIVFFALAVVAYDPGRGIMGRRGGPKGEAA