Protein Info for GFF3862 in Sphingobium sp. HT1-2

Annotation: Aspartokinase (EC 2.7.2.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00696: AA_kinase
  • amino acids 3 to 229 (227 residues), 157.2 bits, E=1.2e-49
• TIGR00657: aspartate kinase
  • amino acids 62 to 414 (353 residues), 364.5 bits, E=4.6e-113
• PF01842: ACT
  • amino acids 277 to 337 (61 residues), 43.7 bits, E=3.6e-15
  • amino acids 358 to 398 (41 residues), 28.9 bits, 1.5e-10
• PF22468: ACT_9
  • amino acids 282 to 337 (56 residues), 37.4 bits, 3.6e-13
  • amino acids 356 to 413 (58 residues), 83.7 bits, E=1.2e-27
• PF13840: ACT_7
  • amino acids 351 to 411 (61 residues), 60.4 bits, E=2.4e-20

Best Hits

Swiss-Prot: 54% identical to AK_PSEAE: Aspartokinase (lysC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00928, aspartate kinase [EC: 2.7.2.4] (inferred from 89% identity to sjp:SJA_C1-24820)

MetaCyc: 54% identical to aspartokinase (Halomonas elongata DSM 2581)
Aspartate kinase. [EC: 2.7.2.4]

Predicted SEED Role

"Aspartokinase (EC 2.7.2.4)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 2.7.2.4)

MetaCyc Pathways

• aspartate superpathway (25/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (18/18 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (9/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (9/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (8/8 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• ectoine biosynthesis (5/5 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• L-lysine biosynthesis II (7/9 steps found)
• dipicolinate biosynthesis (3/4 steps found)
• spermidine biosynthesis II (3/4 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• L-methionine biosynthesis IV (2/4 steps found)
• norspermidine biosynthesis (3/6 steps found)
• superpathway of polyamine biosynthesis III (4/8 steps found)
• 3-dehydroquinate biosynthesis II (archaea) (3/7 steps found)
• cremeomycin biosynthesis (2/7 steps found)
• grixazone biosynthesis (2/8 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.7.2.4

Use Curated BLAST to search for 2.7.2.4

Protein Sequence (421 amino acids)

>GFF3862 Aspartokinase (EC 2.7.2.4) (Sphingobium sp. HT1-2)
MARIVMKFGGTSMAGMERIRNVAARVKHVVDQGHEVAVVVSAMAGETDRLVGFCKEASAL
YDPAEYDVVVAAGEQVTSGLLAMTLKAIGVDARSWLGWQLPIRTIEAHAKARISTIETDA
LIAAMQSGQVAVIPGFQGMMDDGRVSTLGRGGSDTSAVAVAAAVKADRCDIYTDVDGVYT
TDPRIVARARKLDLVTYEEMLELASVGAKVLQTRSVGLAMKEGVVVQVLSSFDDPTQDDL
PGTLIVSDEELEAKLKETKMERQLITGIAHDKNEAKIIVTRVPDKPGAVASIFTPLADAA
INVDMIIQNDSKDNEETDVTFTVPRADLARSVDILEANKDAIGFRRIITDTEVAKISVVG
VGMRSHAGVAATMFKTLAERGINIEAISTSEIKVSVLIDEDETELAVRVLHTAYGLDAPA
A