Protein Info for GFF3862 in Sphingobium sp. HT1-2

Annotation: Aspartokinase (EC 2.7.2.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 PF00696: AA_kinase" amino acids 3 to 229 (227 residues), 157.9 bits, see alignment E=7.1e-50 TIGR00657: aspartate kinase" amino acids 62 to 414 (353 residues), 364.5 bits, see alignment E=4.6e-113 PF01842: ACT" amino acids 277 to 337 (61 residues), 43.7 bits, see alignment E=3.6e-15 amino acids 358 to 398 (41 residues), 28.9 bits, see alignment 1.5e-10 PF22468: ACT_9" amino acids 282 to 337 (56 residues), 38.3 bits, see alignment 1.8e-13 amino acids 356 to 413 (58 residues), 83.9 bits, see alignment E=1.1e-27 PF13840: ACT_7" amino acids 351 to 411 (61 residues), 60.2 bits, see alignment E=2.9e-20

Best Hits

Swiss-Prot: 54% identical to AK_PSEAE: Aspartokinase (lysC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00928, aspartate kinase [EC: 2.7.2.4] (inferred from 89% identity to sjp:SJA_C1-24820)

MetaCyc: 54% identical to aspartokinase (Halomonas elongata DSM 2581)
Aspartate kinase. [EC: 2.7.2.4]

Predicted SEED Role

"Aspartokinase (EC 2.7.2.4)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 2.7.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.2.4

Use Curated BLAST to search for 2.7.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (421 amino acids)

>GFF3862 Aspartokinase (EC 2.7.2.4) (Sphingobium sp. HT1-2)
MARIVMKFGGTSMAGMERIRNVAARVKHVVDQGHEVAVVVSAMAGETDRLVGFCKEASAL
YDPAEYDVVVAAGEQVTSGLLAMTLKAIGVDARSWLGWQLPIRTIEAHAKARISTIETDA
LIAAMQSGQVAVIPGFQGMMDDGRVSTLGRGGSDTSAVAVAAAVKADRCDIYTDVDGVYT
TDPRIVARARKLDLVTYEEMLELASVGAKVLQTRSVGLAMKEGVVVQVLSSFDDPTQDDL
PGTLIVSDEELEAKLKETKMERQLITGIAHDKNEAKIIVTRVPDKPGAVASIFTPLADAA
INVDMIIQNDSKDNEETDVTFTVPRADLARSVDILEANKDAIGFRRIITDTEVAKISVVG
VGMRSHAGVAATMFKTLAERGINIEAISTSEIKVSVLIDEDETELAVRVLHTAYGLDAPA
A