Protein Info for GFF3860 in Xanthobacter sp. DMC5

Annotation: Hydrazine synthase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR03866: PQQ-dependent catabolism-associated beta-propeller protein" amino acids 20 to 327 (308 residues), 514 bits, see alignment E=1.2e-158 PF10282: Lactonase" amino acids 28 to 92 (65 residues), 21.8 bits, see alignment E=4.2e-08 amino acids 186 to 306 (121 residues), 28.7 bits, see alignment E=3.2e-10 TIGR02276: 40-residue YVTN family beta-propeller repeat" amino acids 29 to 66 (38 residues), 34.9 bits, see alignment 1.2e-12 amino acids 109 to 150 (42 residues), 51.6 bits, see alignment 7.1e-18 amino acids 285 to 326 (42 residues), 50.8 bits, see alignment 1.2e-17

Best Hits

KEGG orthology group: None (inferred from 89% identity to xau:Xaut_0027)

Predicted SEED Role

"FIG00443700: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>GFF3860 Hydrazine synthase subunit beta (Xanthobacter sp. DMC5)
MIPTAPRRLVALLAGAAALMAADAASAYTVYVSNERGNSITVIDSTTLEAKQTVKIGRRP
RGITMSPDGKVLFLCASDDHAVLAIDPATLKVMRKLKSGPDPELFALHPSGNPLYIANED
DNQVTVLDVEQNKVVAQVPVGTEPEGMAVSPDGATLVATSETTSMAHFIDTKTNKIIANV
LVDARPRFAEFSKDGKRLWVSAEVGGTVSVIDPETRKIIHKVTFQIPGVSKEAIQPVGVR
LTKDGKTAFVALGPANRVAVVNAETFEVQKYLLVGQRVWQLAFTPDEKLLFTTNGNSNDV
SVIDVQDLKVVKSIKVGGAPWGVVVSPQ