Protein Info for GFF3859 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG00509877: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 950 998 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 44 to 60 (17 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 191 to 208 (18 residues), see Phobius details amino acids 214 to 230 (17 residues), see Phobius details amino acids 237 to 253 (17 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details PF05231: MASE1" amino acids 21 to 297 (277 residues), 175.8 bits, see alignment E=4.6e-55 TIGR00229: PAS domain S-box protein" amino acids 301 to 425 (125 residues), 101.2 bits, see alignment E=4.7e-33 amino acids 443 to 566 (124 residues), 50.2 bits, see alignment E=2.7e-17 PF00989: PAS" amino acids 305 to 416 (112 residues), 28.2 bits, see alignment E=6.4e-10 amino acids 450 to 558 (109 residues), 33.8 bits, see alignment E=1.2e-11 PF13426: PAS_9" amino acids 316 to 417 (102 residues), 28.1 bits, see alignment E=8.3e-10 amino acids 456 to 560 (105 residues), 28.3 bits, see alignment E=7.2e-10 PF08447: PAS_3" amino acids 328 to 410 (83 residues), 36.4 bits, see alignment E=2.1e-12 PF13188: PAS_8" amino acids 445 to 493 (49 residues), 16.7 bits, see alignment 2.2e-06 PF08448: PAS_4" amino acids 451 to 562 (112 residues), 39.3 bits, see alignment E=2.6e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 570 to 732 (163 residues), 133.8 bits, see alignment E=4.9e-43 PF00990: GGDEF" amino acids 572 to 728 (157 residues), 155 bits, see alignment E=6e-49 PF00563: EAL" amino acids 781 to 982 (202 residues), 90.2 bits, see alignment E=5.8e-29

Best Hits

Predicted SEED Role

"FIG00509877: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (998 amino acids)

>GFF3859 FIG00509877: hypothetical protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VVMSKPSQHVFVTVPHPLLRLVSLGLVAFVFTLFSLVLSRVGTQLAPLWFPTSIMMVAFY
RHAGRLWPGIAVACSLGSIGASLTLFPAASLNFSWTAINIIEAATGAILLRKLLPSYNPL
QNLNDWFRLAIGSAVIPPLLGGLLFWLIAPEAVASKAFLIWVLSEAIGALTLVPLGLLFK
PHYLLRHRDPHLLLETLLTLVITLALSWLAMRYIPWPFTCVIVLLMWSAVRLPRMEAFLI
FLATVIVVSLMLANDPTLLATPKTDVMVNMPWLPFLMILLPANMMTMVMYAFRTERKHIT
ESESRFRNAMEYSAIGMALVGTEGQWLQVNKSLSHFLGYSQDELRTMTFQQLTWPEDLNN
DLEQLNMLVRGDINSYSMEKRYYTRNGDVVWALLAVSLVRHKDNKPLYFIAQIEDINDLK
QSEQENQRLMERITQANEALFQEKERLHITLDSIGEAVVCIDVAMNITFMNPIAEKMSGW
RQEDALGTPLLTVLRITSGDKGPLLEDIYRADRSRSDMEQEIVLHCHNGGSYDIHYSITP
LSTLDGDKIGSVLVIQDVTESRKMLRQLSYSATHDALTQLANRASFEKQLQQRLQTIQES
PQHHALVFIDLDRFKAVNDSAGHAAGDALLRELASLMLSMLRSGDLLARLGGDEFGLLLP
DCNSDSARFIATRLINAINEYHFMWEGRLHRIGASAGITMINEHNCQLTEVVSQADIACY
AAKNSGRGRLTVYEPQHALTSSKGMMPLEEQWHMIKNNHLLMLARNVAPPRTPEATSFWL
VSLRLWTSEGEVMEERAFRAGLADSALHHALDRRVFHEFFHHAATAVASKGLSVALPLSA
AGLYSATLIDELLEQLEHSPLPPRLLHLIIPADVIVKQAQTAAATLRKLRQRGCQVILSH
VGRDLQLFNLLPLHIVDYLLLDSDLIANVHESLMDEMLTSIIQGHAQHLDIKTLAGPVQN
PQVLDTLSRIGVDLIYGDTIAEAQPLDLLLNTSYFAIH