Protein Info for PS417_19755 in Pseudomonas simiae WCS417

Annotation: flagellar motor switch protein FliM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 TIGR01397: flagellar motor switch protein FliM" amino acids 5 to 319 (315 residues), 354.4 bits, see alignment E=2.8e-110 PF02154: FliM" amino acids 38 to 229 (192 residues), 245.5 bits, see alignment E=4.3e-77 PF01052: FliMN_C" amino acids 251 to 319 (69 residues), 67.3 bits, see alignment E=9e-23

Best Hits

Swiss-Prot: 89% identical to FLIM_PSEAE: Flagellar motor switch protein FliM (fliM) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02416, flagellar motor switch protein FliM (inferred from 99% identity to pfs:PFLU4428)

Predicted SEED Role

"Flagellar motor switch protein FliM" in subsystem Bacterial Chemotaxis or Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U6U1 at UniProt or InterPro

Protein Sequence (322 amino acids)

>PS417_19755 flagellar motor switch protein FliM (Pseudomonas simiae WCS417)
MAVQDLLSQDEIDALLHGVDDGLVQTEMAAEPGSVKSYDLTSQDRIVRGRMPTLEMINER
FARYTRISMFNMLRRSADVAVGGVQVMKFGEYVHSLYVPTSLNLVKIKPLRGTALFILDA
KLVFKLVDNFFGGDGRHAKIEGREFTPTELRVVRMVLEQAFIDLKEAWQAIMEVNFEYIN
SEVNPAMANIVGPSEAIVVSTFHIELDGGGGDLHVTMPYSMIEPVREMLDAGFQSDLDDQ
DERWVKALREDLLDVDVPLSATVARRQLRLRDILHMQPGDIIPVELPEEMIMRANGVPSF
KVKLGSHKGNLALQVVEPINRR