Protein Info for GFF3856 in Xanthobacter sp. DMC5

Annotation: Hydrazine synthase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF21783: YNCE" amino acids 54 to 111 (58 residues), 30.8 bits, see alignment E=5e-11 amino acids 134 to 236 (103 residues), 27.9 bits, see alignment E=3.7e-10 TIGR02276: 40-residue YVTN family beta-propeller repeat" amino acids 73 to 112 (40 residues), 37.5 bits, see alignment 9.1e-14 amino acids 156 to 197 (42 residues), 41.5 bits, see alignment 5.2e-15 amino acids 199 to 237 (39 residues), 43.5 bits, see alignment 1.2e-15 amino acids 240 to 278 (39 residues), 39.8 bits, see alignment 1.7e-14 amino acids 281 to 316 (36 residues), 41.7 bits, see alignment 4.4e-15 PF02239: Cytochrom_D1" amino acids 165 to 269 (105 residues), 31.4 bits, see alignment E=1.9e-11

Best Hits

KEGG orthology group: None (inferred from 74% identity to xau:Xaut_0031)

Predicted SEED Role

"FIG01023871: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>GFF3856 Hydrazine synthase subunit beta (Xanthobacter sp. DMC5)
MARLRRAAAAAGFAAAVVLLVASRPSGAAEAFITNQPGNEVAVVALNGAAAPPKLVARIP
VPGEPAGIAVSRDGSRAFVTSPEGKALSVIDTATRQVEKRIPVGGGPLGVAVAPSGKPVY
VADWYASRLVVVDPDRPDDLRIAHTGASPSGVAVTPDGALVLSADRDDDQVSIIEAATLE
RVAVVKVGTRPFGITLSEDGRTAYTANVGSDDVSVIDVAARKVVGTVKVGNRPYAVALAG
TLAFVTNQYAGTVSVFDTTTLAPRATISVGEYPEGIAASKDGRAVYVVNWFDNSMSVIDT
QTLKVVSTLEVGDGPRAFGLFLRRTP