Protein Info for GFF3856 in Sphingobium sp. HT1-2

Annotation: TPR domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 678 PF13432: TPR_16" amino acids 51 to 114 (64 residues), 31 bits, see alignment E=1.5e-10 amino acids 86 to 133 (48 residues), 19.7 bits, see alignment 5.3e-07 amino acids 156 to 212 (57 residues), 16.3 bits, see alignment 6e-06 amino acids 221 to 282 (62 residues), 24.3 bits, see alignment 1.9e-08 amino acids 288 to 324 (37 residues), 16.2 bits, see alignment 6.7e-06 PF13174: TPR_6" amino acids 83 to 111 (29 residues), 13.5 bits, see alignment (E = 5.6e-05) amino acids 254 to 280 (27 residues), 13.4 bits, see alignment (E = 6e-05) PF13428: TPR_14" amino acids 252 to 290 (39 residues), 28.7 bits, see alignment 7.2e-10 PF13181: TPR_8" amino acids 283 to 309 (27 residues), 17.8 bits, see alignment (E = 1.6e-06) PF00685: Sulfotransfer_1" amino acids 425 to 619 (195 residues), 34.2 bits, see alignment E=9.9e-12 PF13469: Sulfotransfer_3" amino acids 427 to 618 (192 residues), 161.1 bits, see alignment E=2.8e-50

Best Hits

KEGG orthology group: None (inferred from 68% identity to nar:Saro_3035)

Predicted SEED Role

"TPR domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (678 amino acids)

>GFF3856 TPR domain protein (Sphingobium sp. HT1-2)
MGNASAVPATDSIQTALADAAALLDARPDAALAQAEAILRRAGRLPPAELLIGQALRRLG
KPKAALARLAPLARQHPTAPAILWELAQAAREAGDQRQAIGALESLTRQQPGVPGGWFLL
AGLLRASGRDSDAWRADLSGVHAASRDRDLLEAAMAMNEGRLDDAAALLTARADRLPDDP
AGIRLMGEVQWRRGDMNAALAHVERAVALAPGFDLARDFLIRLLLQNNRLSEALAHAETL
ARSPIHNPGYDLIRASVLVRLGDQDAARAIYERLLADRPDQPQVWQNLGHALKTLGRQAD
AVHAYRQAVHHRPTMGEAWWSLANLKTVKLDAADIATMERALETLARDGQTEGEDVFHLH
FSLGKAQEDRKADEAAFRHYDAGNRLRRAMIRHDAGEFSAEVAATATTFSAPFIAAMGDG
GCPAPDPIFIVGLPRAGSTLVEQILASHSQVEGTMELPEMMMIASRLQSRVDDGEFADFA
AMVASLTPADRQRLGEEYVEQTRVHRQSGKPRFIDKMPNNWQHVGLIKLILPNASIIDAR
RHPMGCCFSGWKQHFARGQAFTYDLTDIGLYYRDYVALMAAYDAAAPGRVHRVIYERMVA
DTPGEVDRLLAYLGLDFEAACLSFWQTDRAVRTASSEQVRQPIYTGGVDHWRRFEPWLAP
LADALGPIAHSYPDLPPR