Protein Info for GFF3855 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 169 to 192 (24 residues), see Phobius details PF08521: 2CSK_N" amino acids 36 to 169 (134 residues), 114.5 bits, see alignment E=1.3e-36 PF00672: HAMP" amino acids 193 to 244 (52 residues), 25.9 bits, see alignment 3.1e-09 PF26769: HAMP_PhoQ" amino acids 196 to 245 (50 residues), 32.1 bits, see alignment 2.7e-11 PF00512: HisKA" amino acids 251 to 308 (58 residues), 50.1 bits, see alignment 6.9e-17 PF13581: HATPase_c_2" amino acids 337 to 460 (124 residues), 30.1 bits, see alignment E=1.3e-10 PF02518: HATPase_c" amino acids 359 to 464 (106 residues), 83.4 bits, see alignment E=4.7e-27

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (470 amino acids)

>GFF3855 hypothetical protein (Sphingobium sp. HT1-2)
MPNEGRPSGEGRAIALRTRLLAAMLGPMLGAAAIIGVGGATLISDVVRRTNDRVLGGALG
AIAETVQVERGEVTLDLPPAAFGMLENSERDNVYYRIAVGGTLLTGYADLPAPDPRTMPV
DQPRFRFARYRGQDIRIGEVKRSLPRIADPVIVQVAETLDNRRALMHRLMIALLIGELTL
VGVAILLLRPALGWSLRPLLRLRRAVEVRDGGARPDFSALDAGPLPSELRPLARAFNRLL
RQLDQATGGVRRFTADASHQMRTPISVLKVQIELARRGSREAFDEIADAAQRLERLVTQL
LALARAEEAGASPPLETVDLKEVSAVVVNRLINQAIQAQVELNLEASEAESYRVEAHRTL
VFEILANLVDNGIRYNRPGGTVTIALAQGEDATLMTVSDDGPGIAVEHRDKVFERFFRVG
GASAPEGTGLGLAIVQSAASRMGAQVEIVEGGAGTHIRVRFPRRAENGGA