Protein Info for GFF3853 in Sphingobium sp. HT1-2

Annotation: ABC-type Fe3+ transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01547: SBP_bac_1" amino acids 56 to 298 (243 residues), 49.2 bits, see alignment E=1.6e-16 PF13531: SBP_bac_11" amino acids 57 to 304 (248 residues), 54.7 bits, see alignment E=2.5e-18 PF13416: SBP_bac_8" amino acids 63 to 313 (251 residues), 65.3 bits, see alignment E=1.6e-21 PF13343: SBP_bac_6" amino acids 111 to 311 (201 residues), 42.6 bits, see alignment E=1.1e-14

Best Hits

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 54% identity to sur:STAUR_0099)

Predicted SEED Role

"ABC-type Fe3+ transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>GFF3853 ABC-type Fe3+ transport system, periplasmic component (Sphingobium sp. HT1-2)
MRRVIQIVAALASLSVTSATAVAQRPTGYPRSYDDLIGDARAERQVIVYANADTSEMAPV
ILAFQRRYPGVTVSYSDLGSNEMFRRFSTEARSGRMSADLVWSSAMDQQVKLINDGFAQA
YASPEKPALPANAVWKNMGFGVTAEPIAYVYNKKAIPNPPRSHAALEAMLRKDRKTLTGK
VATFDPARSNTGYLYLTQDYAITRDTGSLVEAMAATRPQLHITTEPMLRGVAEGKFSIAY
NVIGSYAQERARRDPRIGVVFPEDYTIVMSRIAFIAREARHPAAAKLFLDFLLSREGQSL
LAQHSLWPVRTDINGRRLPAAQARSIRVGPQLLVNLDRLTRQRFLREWQAALVSGAR