Protein Info for GFF3851 in Variovorax sp. SCN45

Annotation: Uncharacterized MFS-type transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 203 to 222 (20 residues), see Phobius details amino acids 242 to 259 (18 residues), see Phobius details amino acids 266 to 287 (22 residues), see Phobius details amino acids 293 to 316 (24 residues), see Phobius details amino acids 328 to 351 (24 residues), see Phobius details amino acids 357 to 377 (21 residues), see Phobius details PF07690: MFS_1" amino acids 15 to 321 (307 residues), 68.7 bits, see alignment E=2.2e-23

Best Hits

KEGG orthology group: None (inferred from 85% identity to vpe:Varpa_1524)

Predicted SEED Role

"major facilitator superfamily MFS_1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (383 amino acids)

>GFF3851 Uncharacterized MFS-type transporter (Variovorax sp. SCN45)
MVAITAATRWASRAQFFSAGFIFATWGVHVPTVKSHYGIDEAQLGLAMLAAGAGAMVGLT
SAGRWIGRYGPRRMAGVCGCIYALLLAGLIAMPGYAALLGLLAAFGLVTSVFDVSINTEA
AQLELHGDTPLMSGMHGMFSLGGMAGAASGSAALAAGLGPQAHLLLVAAAMVLLVAVASR
RMLPRPATSGATEADHGFLLPRGTLAVLGVLAALGLIAEGAIYDWSVLYMQQEIGSPQQQ
AALAYASFSAAMAAARFGGDAMRARFAPATLLLGSGLLAAAAMTLVLVTDMPWLALVGFA
GVGVGFANVVPILFSASARVPGVEPARGIASVSAVAYLGFMAGPAVIGLLARATSLTAAL
YVVVAFAVALAASARYTASSESK