Protein Info for GFF3851 in Sphingobium sp. HT1-2

Annotation: Citrate/H+ symporter of CitMHS family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 26 to 46 (21 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 96 to 126 (31 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 234 to 267 (34 residues), see Phobius details amino acids 283 to 306 (24 residues), see Phobius details amino acids 320 to 344 (25 residues), see Phobius details amino acids 348 to 357 (10 residues), see Phobius details amino acids 381 to 402 (22 residues), see Phobius details amino acids 409 to 432 (24 residues), see Phobius details TIGR00784: citrate transporter" amino acids 3 to 426 (424 residues), 565.9 bits, see alignment E=3.7e-174 PF03553: Na_H_antiporter" amino acids 10 to 177 (168 residues), 32.4 bits, see alignment E=6.1e-12 PF03600: CitMHS" amino acids 15 to 377 (363 residues), 124.5 bits, see alignment E=5.5e-40

Best Hits

Swiss-Prot: 58% identical to CITN_BACSU: Citrate transporter (citN) from Bacillus subtilis (strain 168)

KEGG orthology group: K03300, citrate-Mg2+:H+ or citrate-Ca2+:H+ symporter, CitMHS family (inferred from 60% identity to pfl:PFL_0105)

Predicted SEED Role

"Uncharacterized transporter, similarity to citrate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>GFF3851 Citrate/H+ symporter of CitMHS family (Sphingobium sp. HT1-2)
MNLALLGFLMVATFMTLIMTKRMTPLVALIVIPSLFGVIAGQAAGLGDMMIDGIKNLAPT
GVMLLFAILFFSTMTDTGLFDPLVARLVKIVHGDPLLILLGTVVLCAIVSLDGDGSTTYI
ITIAALLPLYKRFDMNRLYLVCLLMVTSGIMNLTPWGGPTARAASALKLDPATLFLPLIP
GMIAGLAFLLGLAFWFGIKERRRLGKVQARQSVAPSDLGVSQYPEARRPHLRWFNGLLVV
ALLVLLVWGVLPLSVLMMIAFAIAMIVNYPGVAQQKERIAAHAGNVLSVVSLIFAAGIFT
GILGGTGMVEAMSKEVVGVIPPALGPYMAPITALLSMPFTFFISNDAFYFGMLPILAEAG
AHYGVEPMAIARASLMGQPVHLLSPLVPSTYLLVSLAGVDLADHQRFTLLPAAAVGIVMT
LVGMIALAFPFVA