Protein Info for GFF3850 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Response regulator BaeR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00072: Response_reg
  • amino acids 13 to 122 (110 residues), 87.2 bits, E=9e-29
• PF00486: Trans_reg_C
  • amino acids 156 to 231 (76 residues), 84.3 bits, E=5.3e-28

Best Hits

Swiss-Prot: 97% identical to BAER_ECOLI: Transcriptional regulatory protein BaeR (baeR) from Escherichia coli (strain K12)

KEGG orthology group: K07664, two-component system, OmpR family, response regulator BaeR (inferred from 98% identity to ses:SARI_00761)

Predicted SEED Role

"Response regulator BaeR"

Protein Sequence (240 amino acids)

>GFF3850 Response regulator BaeR (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTELPIDENTPRILIVEDEPKLGQLLIDYLRAASYAPTLINHGDKVLPYVRQTPPDLILL
DLMLPGTDGLTLCREIRRFSDIPIVMVTAKIEEIDRLLGLEIGADDYICKPYSPREVVAR
VKTILRRCKPQRELQQQDAESPLMIDESRFQASWCGKALDLTPAEFRLLKTLSLEPGKVF
SREQLLNHLYDDYRVVTDRTIDSHIKNLRRKLESLDAEQSFIRAVYGVGYRWEADACRLV