Protein Info for PS417_01960 in Pseudomonas simiae WCS417

Annotation: pilus assembly protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 TIGR01175: type IV pilus assembly protein PilM" amino acids 11 to 185 (175 residues), 170.1 bits, see alignment E=3.4e-54 PF11104: PilM_2" amino acids 15 to 182 (168 residues), 165.9 bits, see alignment E=6.2e-53

Best Hits

Predicted SEED Role

"Type IV pilus biogenesis protein PilM" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U901 at UniProt or InterPro

Protein Sequence (217 amino acids)

>PS417_01960 pilus assembly protein (Pseudomonas simiae WCS417)
MAKGFFTGKARTLLGVDINDTAIRLIELGRSPSGFNIQGYVTQALPAQTVVDGTLLDLEG
VGRALRSAWSRLSTSVRGAAAAVAGPSVITRMIDLEAGLTDDEMAWMIQMEADQYIPYPL
DDVAIDFQVRGPTALDPNRVEVLLAACLKEQVEAREAVLALAGLVPKVIDVEAFALARAC
SQDFASFTPSHRVDGAQWAVDAQGMGIACGLALRSFA