Protein Info for PS417_19710 in Pseudomonas simiae WCS417

Annotation: flagellar biosynthesis protein FlhA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 709 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 241 to 267 (27 residues), see Phobius details amino acids 287 to 305 (19 residues), see Phobius details amino acids 311 to 328 (18 residues), see Phobius details TIGR01398: flagellar biosynthesis protein FlhA" amino acids 21 to 705 (685 residues), 850.9 bits, see alignment E=3.4e-260 PF00771: FHIPEP" amino acids 31 to 697 (667 residues), 876.3 bits, see alignment E=7.8e-268

Best Hits

Swiss-Prot: 53% identical to FLHA_ECOLI: Flagellar biosynthesis protein FlhA (flhA) from Escherichia coli (strain K12)

KEGG orthology group: K02400, flagellar biosynthesis protein FlhA (inferred from 99% identity to pfs:PFLU4420)

Predicted SEED Role

"Flagellar biosynthesis protein FlhA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UL40 at UniProt or InterPro

Protein Sequence (709 amino acids)

>PS417_19710 flagellar biosynthesis protein FlhA (Pseudomonas simiae WCS417)
MDRSQMLGTARTTLTDLSRGNLGVPLLLLVMLAMMMLPMPPFLLDVFFTFNIALSVVVLL
VCVYALRPLDFAVFPTILLVATLLRLALNVASTRVVMLHGQDGHAAAGKVIQAFGEVVIG
GNYVVGIVVFAILMIINFVVVTKGAGRISEVSARFTLDAMPGKQMAIDADLNAGLIDQNQ
AKSRRLEVAQEAEFYGSMDGASKFVRGDAIAGLLILFINLIGGMAVGIFQHGMTFGDAGK
VYALLTIGDGLVAQLPSLLLSTAAAIMVTRASGSEDMGKQISRQMFASPKALAVAAGIMA
IMGIVPGMPHVSFLSMAAMAAGGAYLFWKKQNAVKVQAQQEIARQQELLPSPARAQETKE
LGWDDVTPIDMIGLEVGYRLIPLVDRNQGGQLLARIKGVRKKLSQDLGFLMPTVHIRDNL
DLAPSAYRLTLMGVILAEAEIYPDRELAINPGQVFGSLNGITAKDPAFGLDAVWIEISQR
SQAQSLGYTVVDASTVVATHLNQILYKHSHELIGHEEVQQLMGLLAKASPKLAEELVPGV
LSLSQLLKVLQALLAEQVPVRDIRSIAEAIANNAAKSQDTAALVAAVRVGLSRAIVQSIV
GLDSELPVITLEPRLEQILLNSIQKAGQGQEEGVLLEPSMAEKLQRSLIDAAQRQEMQGQ
PVILLVAGPVRAMLSRFGRLAVPNLHVLAYQEIPDNKQVTIVATVGPNG