Protein Info for GFF3849 in Sphingobium sp. HT1-2

Annotation: Putative transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 82 to 98 (17 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details TIGR03717: integral membrane protein, YjbE family" amino acids 24 to 204 (181 residues), 192 bits, see alignment E=3.8e-61 PF03741: TerC" amino acids 26 to 204 (179 residues), 152 bits, see alignment E=7.3e-49

Best Hits

KEGG orthology group: None (inferred from 69% identity to sjp:SJA_C1-00350)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (217 amino acids)

>GFF3849 Putative transmembrane protein (Sphingobium sp. HT1-2)
MNDIWTHIVADFSNLGSPSALAAFGQVVLIDIMLAADNAIVVGALAAGLPPASRRKVIAI
GVIAALVLRIAFALLVTQLMQLVGLVFAGGLLLVWVGWKMWRELRAHGEPEDAEHMAGKA
APKGFAQAAWAVAIADVSMSLDNVLAVAGAAREHPGILVIGLVLSVALMGVAANLLARVI
ERYRAIAYFGLIVILYVAGKMIYEGAIDPATGLITLF