Protein Info for GFF3848 in Xanthobacter sp. DMC5

Annotation: DNA mismatch repair protein MutS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 928 PF01624: MutS_I" amino acids 42 to 158 (117 residues), 139.4 bits, see alignment E=1.7e-44 TIGR01070: DNA mismatch repair protein MutS" amino acids 42 to 922 (881 residues), 842 bits, see alignment E=3e-257 PF05188: MutS_II" amino acids 167 to 295 (129 residues), 65.7 bits, see alignment E=1.8e-21 PF05192: MutS_III" amino acids 318 to 613 (296 residues), 142.4 bits, see alignment E=7.1e-45 PF05190: MutS_IV" amino acids 477 to 572 (96 residues), 69 bits, see alignment E=1.1e-22 PF00488: MutS_V" amino acids 672 to 859 (188 residues), 282.1 bits, see alignment E=7.3e-88 PF27441: MutS_C" amino acids 894 to 924 (31 residues), 49.8 bits, see alignment (E = 6.9e-17)

Best Hits

Swiss-Prot: 75% identical to MUTS_AZOC5: DNA mismatch repair protein MutS (mutS) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K03555, DNA mismatch repair protein MutS (inferred from 87% identity to xau:Xaut_0035)

Predicted SEED Role

"DNA mismatch repair protein MutS" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (928 amino acids)

>GFF3848 DNA mismatch repair protein MutS (Xanthobacter sp. DMC5)
MRPTATKTAAEETPPEEASAPAPASSAPAKPAPAKVDETRVTPMMAQYMEIKAANPDSLL
FYRMGDFYELFFADAEQASQALGIVLTKRGKHLGEDIPMCGVPIDRAEEYLHKLIALGFR
VAVCEQLEDPAEAKKRGGKSVVRRDVTRLVTPGTITEDSLLDARRENVLAALARVRAGSG
ADDFAYAIAFTDMSTGAFRVAGTTRAALSGDLARVDPAELLVSDALLDDAELRAMLRDLP
AVTPLPRQSFDGAGAEKRLADFYGVAALDAFGAFARAELIAAAAVVAYVDRTQLGAKPLL
ARPVREAEGGIMAIDAGTRANLELVRTTSGDRRGSLLAAVDRTVTAAGARLLARRIAEPL
TDLAAIRARHDGVGHLCEDGALRRALREALARAPDMARAVTRLALQRGGPRDLAAVRDGL
DGALAIAGLIGPDAPDDLSRAARALSRAPHAVALDLASALAENLPVHRRDGGFVREGCDP
ELDATRALRDESRRVVAALERRYVEETGVRSLKIRHNAVLGYYVEVTQQNADRLREPPHD
AVFVHRQTMAGAMRFSSVELGDLESRIASAGERALALEQAIFERLSAAVVAETDAIRVAA
DALAELDVASGLAELAATEAHVRPHMEEGVAFAIVGGRHPVVEQALARDGGPFVPNDCDL
SPPEGDKDGRIVLVTGPNMAGKSTFLRQNALIAVLAQAGAFVPARSARIGVVDRLFSRVG
AADDLARGRSTFMVEMVETAAILNQATPRSLVILDEIGRGTATFDGMSIAWASLEHLHEV
NRCRALFATHFHELTALSQRCRRLSNATVKVTEWHGDVIFLHEVVPGAADRSYGIQVAKL
AGLPEAVIARAKAVLAELEAAERASPAQKLIDDLPLFAVRPKPAEKAAQADPAADAVIGA
LDDLDPDALSPREALDALYRLKGLRRDS