Protein Info for PS417_19705 in Pseudomonas simiae WCS417

Annotation: flagellar biosynthesis regulator FlhF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 TIGR03499: flagellar biosynthesis protein FlhF" amino acids 1 to 306 (306 residues), 248.6 bits, see alignment E=6.3e-78 PF00448: SRP54" amino acids 220 to 408 (189 residues), 159.2 bits, see alignment E=5e-51

Best Hits

Swiss-Prot: 86% identical to FLHF_PSEPU: Flagellar biosynthesis protein FlhF (flhF) from Pseudomonas putida

KEGG orthology group: K02404, flagellar biosynthesis protein FlhF (inferred from 99% identity to pfs:PFLU4419)

Predicted SEED Role

"Flagellar biosynthesis protein FlhF" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U6T0 at UniProt or InterPro

Protein Sequence (438 amino acids)

>PS417_19705 flagellar biosynthesis regulator FlhF (Pseudomonas simiae WCS417)
MQVKRFFAADMRQAMKLVRDELGADAAIIGNRRIAGGVELTAALDYTPQALAPRVPNMEL
EDELRKTASRIVSAQAELSMRGDSDATTNRQLFAGLPLTASEPLVEPTFKEPPRPAAPAP
APAVDQRVFDSMRFELNGLRELLEVQLGSLAWNQLQGSKPQQANLWRRLQRIGLSGPLSR
DLLALTTEIEEPRQAWRMLLAHLARMIVTPEIEPLEEGGVIAMVGPAGMGKTTTLAKLAA
RYVLKYGAQNIALVSMDSYRIGAQEQLKTLGRILNVSVTHVDPGQSLANALDPLLRKRVV
LIDTAGLQASDPALRMQLESLAGRGIKSKNYLVLATTSQKQVLTAAYHSYKRCGLAGCIL
TKLDETASLGEVLSLAISHELPVAYLTDGPRIPDDLHLPRRHQLVSRAVSVQMQEEPSEE
AMADMFADLYHNPAKRVG