Protein Info for GFF3848 in Sphingobium sp. HT1-2

Annotation: DedA-family integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 transmembrane" amino acids 18 to 77 (60 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 178 to 201 (24 residues), see Phobius details PF09335: VTT_dom" amino acids 40 to 163 (124 residues), 67.8 bits, see alignment E=6.4e-23

Best Hits

Predicted SEED Role

"DedA-family integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (216 amino acids)

>GFF3848 DedA-family integral membrane protein (Sphingobium sp. HT1-2)
MSDLSDLILDMITRYGWWSGPIIGVLAFFESLVVIGLFVPAIATMIAVGGLIGAGLVDPA
PVFACAVFGAILGDWVSYTLGRSVGPAIYRHRWLRGHRLAFARARLFFRRYGFISVLLGR
FLGPVRSTVPVVAGVVKMPHGPFQIANILSALLWVPALLLPGYLAGGRLTHFDFEAEHFA
MMALGLCLVPLLLGWLAIRFFNKPRQRHRTMSAQRG