Protein Info for PS417_19695 in Pseudomonas simiae WCS417

Annotation: flagellar biosynthesis sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 18 to 239 (222 residues), 116.9 bits, see alignment E=7.1e-38 PF04542: Sigma70_r2" amino acids 20 to 92 (73 residues), 64.5 bits, see alignment E=1.3e-21 TIGR02479: RNA polymerase sigma factor, FliA/WhiG family" amino acids 20 to 240 (221 residues), 273.4 bits, see alignment E=1.6e-85 PF04539: Sigma70_r3" amino acids 101 to 167 (67 residues), 44.5 bits, see alignment E=2.7e-15 PF08281: Sigma70_r4_2" amino acids 185 to 228 (44 residues), 37.1 bits, see alignment 3.9e-13 PF04545: Sigma70_r4" amino acids 189 to 237 (49 residues), 65.8 bits, see alignment 4e-22

Best Hits

Swiss-Prot: 83% identical to FLIA_PSEAE: RNA polymerase sigma factor FliA (fliA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02405, RNA polymerase sigma factor for flagellar operon FliA (inferred from 99% identity to pfs:PFLU4417)

Predicted SEED Role

"RNA polymerase sigma factor for flagellar operon" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZQ2 at UniProt or InterPro

Protein Sequence (246 amino acids)

>PS417_19695 flagellar biosynthesis sigma factor (Pseudomonas simiae WCS417)
MTATGYNAYKRSARDSQGELIERYAPLVKRIAYHLLARLPASVQVEDLIQAGMIGLLEVS
TKYDASKGASFETYAGIRIRGAMLDEVRKGDWAPRSVHRNTRMVSDAIRAIEAKTGRDAK
DHEVAAELQLSLDDYYGILNDTLGSRLFSFDDLLQDGEHEGLHEDGASAHMEPSRDLEDE
RFQGALADAIANLPERERLVLALYYDEELNLKEIGEVLGVSESRVSQLHSQCAARLRGRL
GEWRAR