Protein Info for GFF384 in Sphingobium sp. HT1-2

Annotation: Chromosomal replication initiator protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 PF11638: DnaA_N" amino acids 24 to 87 (64 residues), 34.4 bits, see alignment E=2.9e-12 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 26 to 470 (445 residues), 454.7 bits, see alignment E=2e-140 PF00308: Bac_DnaA" amino acids 137 to 296 (160 residues), 185.7 bits, see alignment E=1.5e-58 PF00004: AAA" amino acids 173 to 289 (117 residues), 31.6 bits, see alignment E=4.1e-11 PF08299: Bac_DnaA_C" amino acids 381 to 449 (69 residues), 100.5 bits, see alignment E=8.3e-33

Best Hits

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 45% identity to amv:ACMV_00010)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (472 amino acids)

>GFF384 Chromosomal replication initiator protein DnaA (Sphingobium sp. HT1-2)
MKDNAAVLGIQDGEAAADMARLESAWTTIRTGLRRDIGARMFDQWLKPARLGDYCPDSQT
LDLHFASDFSANFVSGQFGDRLRMAWRCSGAGVREVRLRRAPDSSGPRLLEVKRDVAAAV
TAPAIVAAAPTVACNFQPRHAFDQFVPGETNQLAYSAALAMAGEAEPRFTPLFIHGGTGQ
GKTHLLHSIARAFSAHSPSAPVLYMSAERFMVEFVNSMRSNETMAFKARLRAARLLLIDD
IQFIAGKGSTQEEFLHTINDLIDTGARIVVTADRAPQMLDGIDPRILSRLAGGLVADIRP
AGLDLRLAILEARRAHAGDPPVPDAVIDFLARSIRSNVRELEGAFNKLVAYGQLTGRSID
LEFAQTMLADAVRANVRRLTIDEIQKACAAHFKIDLSEMKSKRRARAVARPRQVAMYISK
KMTPRSLPEIGRTFGGRDHSTVIHAVRTIEKLRESHPDMDADVRALMRQLEG